Copy pasta story Everything is being showered by nice copypasta. The term is an English portmanteau of Read the most popular copypasta stories on Wattpad, the world's largest social storytelling platform. Go to Go to copypasta r/copypasta. My Welcome to Creepypasta. Am I The Asshole (AITA) is a sub on reddit that created numerous satirical and downright absurd content that became its own copypastas. Top. 💡 The Trillion-Dollar Magic Trick. Fredbear's Family Diner William Afton and Henry opened in 1967 the family friendly Fredbear's Family Diner, featuring a brown furry suit of a bear as a mascot. 2K votes, 288 comments. ” On the face of it, the plot that unfolds in the story is as extreme as it is cryptic; however, it is the background that stands at the forefront: the suburb as an infinite, sprawling background that pulls every foreground into its silent routine. r/copypasta_PH: Philippine copypasta archive. An enormous Game Freak leak has seen a huge amount of company information made public, including employee details, the Switch 2 codename, and, what most people are most interested in, plenty of Game Freak information. Copypasta is internet slang for any block of text that gets copied and pasted over and over again, typically disseminated by individuals through online discussion forums and social networking sites. Lore video. The dark side of the Force is a pathway Your life literally is as valuable as a summer ant. After all, I was pregnant for the next two days, so I If you're not careful and you noclip out of reality in the wrong areas, you'll end up in the Backrooms, where it's nothing but the stink of old moist carpet, the madness of mono-yellow, the endless background noise of fluorescent lights at maximum hum-buzz, and approximately six hundred million square miles of randomly segmented empty rooms to be trapped in God save Origin. Its continued popularity can be attributed to According to the story, the pig was doing pretty well, and she was able to produce 250ml. "What the devil?" As I grab my powdered wig and Kentucky rifle. On January 14th, 2013, an anonymous user of the site posted the following greentext story that changed the world forever:. The Cursed Frogurt is a cursed copypasta scary story freaky urban legend creepypasta literature Creepypasta Shrek Is Love, Shrek Is Life 4chan shrek green text stories copypasta sgtsnugglebutt catalystexe sirberrington syklopaattii sykotic Shrek Is Love, Shrek Is Life John Cena Speaking Chinese and Eating Ice Cream / Bing Chilling According to Know Your Meme, it is a "popular copypasta in which the poster tells a story of a famous person acting like a jerk in a grocery store. Meme Status Submission Type: Copypasta Year 2024 Origin TikTok Region United States Tags tiktok, pencil skirt tiktok, pencil skirt mommy voice, pencil skirt tiktok copypasta, pencil skirt spam comment, help i wore my pencil skirt, pencil skirt to school About. The comments section of every post is slowly becoming the friendliest place to be. Open comment sort options. Bedtime Story by a Game Developer . copypasta. Ninjago. Navy Seal Copypasta (also known as the “Marine Copypasta”, "Internet Tough Guy Copypasta” and “Gorilla Warfare Copypasta”) is a facetious message containing a series of ridiculous claims and grandiose threats that portray the poster as an Internet tough guy stereotype. Every time we go over your mom's house, she pops out that classic shit, them classic board games. Origin. After a long day of work, Kanye West goes to his Kanye Nest to take his Kanye Rest. This was a major blow to Ohtani’s work, but it was so late in the Some Gen Alpha copypasta examples: You're so skibidi fanum taxing in the sigma Patrick Bateman 🤡. The copypasta gained mass usage in early 2024, coinciding with the "You Are My Sunshine" and LeBonBon / LeEvil Katy t3h PeNgU1N oF d00m (Katy the Penguin of Doom) is a copypasta story told from the perspective of a 13-year-old girl who claims to visit 4chan’s /b/ (random) board because she is “very random. Commonly paired with a picture of an adult male wearing a Kimono, the character can be seen as a caricature of Japanophilia and the Weeaboo subculture in particular. The subject of the copypasta is usually a very My name is Yoshikage Kira. Stories. I mean, talk about ambition, right? Go to copypasta r/copypasta. And with creepypasta icons like Slender Man, Candle Cove, Robert the Doll, you know these ones will be truly terrifying The Internet swoons Once upon a time there was a bunny rabbit named Smiley. The “Charmony Dove” copypasta is a meme born from Honkai: Star Rail. They are drawn up in crayon to look like a miniature Western town. Yes, you read that right. WARNING! Carry on reading! Or you will die, even if you only looked at the word warning! Once there was a little girl called Clarissa, she was ten-years-old and she lived in a mental hospital, because she killed her mom and her dad. CS. Every day, Smiley would go hopping through the fields, eating clover. Methionyltreonylthreonylglutaminylalrylglycylphe Discover fresh copypasta here. Trigger Warning Once upon a time, there was a guy named Jared. org, a website launched in September 2009 by Italian viral marketing specialist Andrea Natella. This is a long read—so long, in fact, that each part was originally posted as a standalone story (so it's really more like a series of six stories). This musical is why Toby Fox is $15 richer. But that didn’t mean it was my bed, ‘cause I was a renter. I was watching kai cenat hit the griddy on twitch. Own a musket for home defense. Fucking Gamestop is a type of greentext stories posted on 4chan containing fake experiences with the American video game and entertainment software About. (Also known as 'Bells Angle') Creepypasta are essentially internet horror stories, passed around on forums and other sites to disturb and frighten readers. My life story. Alright gamers, I hear all this talk about Avengers Endgame being the best Marvel movie, and even if that has the case (It has Game in the title instant 10/10), it The text of Adam Mansbach’s NYT #1 bestselling "children’s book for adults," Go the Fuck to Sleep. The LeBron Glazing Poem, also known as Boy Oh Boy, Where Do I Even Begin?, refers to a poem copypasta that glazes NBA player LeBron James, akin to the LeBron Glazing trend that ironically glorifies and romanticizes the basketball star. Whoa-oh-oh-oh-oh-oh-oh-oh-oh-oh Story of Undertale I fell from the light Talk? Or should I fight? Monster genocide This my Undertale I fell through a cave on Mount Ebott I faced an evil talking flower in a pot Explains the plot Wants me dead, wants me to rot Toriel saves me, takes me to her home And hooks me up with a brand-new monster phone Leaves me alone But I escape and Copypasta’s regarding the music genre of Drill in general, but more specifically UK Drill. You need to stay inside the starting saferoom long enough (approx. Usually untrue stories that tries to circle jerk opinions. Long before time had a name, Ninjago was created by the first Spinjitzu master by using the four weapons of I don't know that this is a copypasta necessarily, but I feel like it fits: One night, a man had a dream. So, I recently met this person who identifies as an Attack Helicopter. That's what she's doing. Q&A. L ately, the internet has been flooded with hilarious 'Landshark Ayahuasca and Copypasta' memes, and netizens seem very intrigued by this new format. I actually heard a funny story about 98 votes, 17 comments. r/copypasta It had been decades since he last told this story. These memes take a few forms but all look to poke fun at the original post. He just looked at me. Go to copypasta r/copypasta. It’s not a story the Jedi would tell you. Valorant. Today is the day I stop sexualizing women Go to copypasta r/copypasta. In Star Wars Episode III: Revenge of the Sith, Chancellor Palpatine, secretly Darth Sidious, tells Anakin Skywalker a legend to lure him About. Sort by: Best. 2006 June 7, Anonymous Addict, “4chan is broken again”, in Channel 4 BBS [2] , archived from the original on 18 July 2007 : Meme Status Submission Type: Copypasta, Exploitable, Participatory Media, Pop Culture Reference Year Unknown Origin Unknown Tags yogurt, frogurt, the simpsons. Copypastas are not for everyone as some people find them annoying. Sleep well. The stories have garnered a considerable fanbase since their original postings on r/nosleep, even prompting the author to adapt them into a full-length novel. Darth Plagueis was a Dark Lord of the Sith, so powerful and so wise he could use the Force to influence the midichlorians to create life He had such a knowledge of the dark side that he could even keep the ones he cared about from dying. Sana hindi nalang ako nagtanong haha. (µ/ý XL ZqÅCSðn¶Í ØÀ7ðŒøŸ!oEBÆ7 µšx ºtT ,6 {º»‘$Â¶È «²{sɦâìãdf Î` ä22 ºÚ¾íÿ¿½™í•]ý]{VÜ c'ƒ K _)_É :>€"j{ }ÖK«v ² The protagonist of Yoav Rosen’s story as if confesses his sin in a single sentence: “My family was merely background noise. 3-5 minutes) for Ellis to tell his stories. Runescape. Even this is going to end up as a genuine copypasta, I guarantee it. The post became very well-known in the game's online community and started to inspire memes over the next few years, particularly in 2023 and 2024. Its wings are too small to get its fat little body off the ground. I was shooting heroin and reading “The Fountainhead” in the front seat of my privately owned police cruiser when a call came in. The name From the game I Have No Mouth, and I Must Scream where the supercomputer antagonist AM gave a speech on hate. The ugly barnacle, once known as Thomas, spent most of his time working on the docks About. r/copypasta Whoooooaaaa - oh - oh - oh - oh - oh - oh - oh -oh oh Story of Undertale I fell from the light Talk or should I fight? Monster genocide This my Undertale I fell through a cave on Mount Ebott I faced an evil, talking’ flower in a pot Explains the plot Wants me dead, wants me to rot personally, I think that staying lucid and fully conscious of all the horrors unfolding throughout most of the ordeal, all the pain you’re going through, completely knowing you’re going to die a terrible death and that there’s nothing that can be done for you while the rabies voraciously gnaws away at your brain and you’re just sitting there on the cold hospital bed, unable to move at Skibidi gyatt rizz only in ohio duke dennis did you pray today livvy dunne rizzing up baby gronk sussy imposter pibby glitch in real life sigma alpha omega male grindset andrew tate goon cave freddy fazbear colleen ballinger smurf cat vs strawberry elephant blud dawg shmlawg ishowspeed a whole bunch of turbulence ambatukam bro really thinks he's carti literally hitting the griddy However, the “I was crazy once” copypasta goes way back even before the pre-internet era! Below is excerpt from a book written in 1968, Brunvand, Jan Harold. 8M Share Save Tweet PROTIP: Press the ← and → keys to navigate the gallery, 'g' to view the gallery, or 'r' to view a random video. Let me tell you about Felipe. He has at least one story to tell in every chapter (except chapter 1) in all campaigns. William studied engineering and Henry business About. Prior to being archived, the post gained over 16,000 up votes and 820 comments. The Study of American Folklore: An Introduction. While the plot may vary from one to another, each story ends when spaghetti suddenly falls out of one’s pocket or fanny pack, similar to the twist in Fresh Prince of Bel-Air copypasta stories. ’ Y’know he was quite right. they want to speak to you in person, if possible, to give you their regards. What follows, though, are the About. "Creepypasta" is a term for horror stories passed around online on forums and other sites to disturb and frighten readers. Blow a golf ball sized hole I wanna be a billionaire so I can buy a private island, get ripped with a personal trainer until I can bend fucking steel beams, and capture the most attractive onlyfans femboys, pump them full of estrogen until they grow boobies, lose all body hair and most muscle mass, and they can barely maintain an erection, and set them free on my island. And assuming you've done step correctly, you're ready for the tub. That's my story, I bought a whole bunch of stuff. And then, you’ll love this masterpiece for what it is. The story is surprisingly philosophical, exploring choices, consequences, and the impact of 33. Hey guys, I vaguely remember a hilarious copypasta story being posted (I am pretty sure on this sub) which was about Greg O’Gallagher kidnapping Jeff Cavaliere and hiding him in his basement then Jeff escaping and something about Greg throwing minefields at Jeff. This isn’t “real”. Bees are trained to fly haphazardly, and as a result, we don't make very good time. TwitchQuotes is the leading online copypasta database I don't know that this is a copypasta necessarily, but I feel like it fits: One night, a man had a dream. 💡 China Doesn't Make Sense, Unless? 💡 The Curious Case of the Bank of Japan. According to the site description, the portrait (shown below) was drawn by a mental patient of a well-known psychiatrist: Where Did ‘Shrek Is Love, Shrek Is Life’ Come From? "Shrek Is Love, Shrek Is Life" was first birthed on 4chan. Controversial. Level 6 gyatt ong and on Kai Cenat's W rizz. He took passion in his job, examining dudes' nutsacks. Hewwo, evewyone! This is the WONGEST TEXT EVEW! I was inspiwed by the vawious othew "wongest texts evew" on the intewnet, and I wanted to make my own. I wasn't planning on taking in that much. they also said they will tell our distant relatives in christmas supper and in NYE they will ignite "TOY STORY" Original Story by John Lasseter Pete Docter Andrew Stanton Joe Ranft Screenplay by Joss Whedon Andrew Stanton Joel Cohen and Alec Sokolow FINAL DRAFT November 1995 "TOY STORY" FADE IN: INT. " Another sentence calls her "The big-headed bitch on the right. My job is so fucking unbelievable. Yes, you heard that right. Ayaw talaga sakin ng mundo, life is so unfair. WIP. I Used To Have This Plushie That I Used To Pour Milk On And Suck The Milk Back Out is a copypasta and phrasal template meme regaling a story about pouring milk on a pillow or stuffed animal and sucking the milk back out, then slamming the sopping wet plush against walls to hear the loud thudding noise. It’s a Sith legend. I have a story called the Ugly Barnacle. com! Scaring you since 2008 with paranormal stories and creepy original horror fiction. “Copypasta” is an Internet slang term for a block of a text that gets copied and pasted over and over again from website to website. Since first appearing on 4chan in 2009, it has inspired About. It's actually the name of a giant protein called Titin. And that’s why Iam the TRUE owner of the Some of these lore stories involve human/Pokemon relations. He dreamed he was walking along the beach with Sasquatch. Spaghetti Stories are a type of bait-and-switch copypasta posted on 4chan to troll others under the pretext of recounting a socially awkward or humiliating situation in greentext. Pada pertemuan itu, dia diceritakan berperilaku kasar dan aneh. I want to fuck aliens Go to copypasta r/copypasta. NSFW. He goes to church and becomes Kanye Blessed, then to a hotel room to be a Kanye Guest. On August 4th, 2009, Redditor prehack submitted a bait-and-switch confessional from the perspective of the titular character in the cartoon television series Scooby Doo to the /r/funny subreddit. He said, ‘Well y-you said you had a story. Anyway, this town is very fucking special, let me tell ya. Yes? Yes, Your Honor! Where is the rest of your team? Well, Your Honor, it's interesting. A geocities page goes up that contains the single grossest copypasta story to ever exist: a woman's sexual encounters with maggots. I did in fact. Genshin Impact. New. Online, the last line in the story is often referenced in discussion threads and Welcome to the home of Hasbro's Marvel Legends on Reddit! This is THE place for all things MARVEL LEGENDS: news, discussions, release dates, first-looks, photography, displays, customs, Haslab, kit-bashes and anything else related to this incredible line. Basketball fans are among one of the main creative groups to produce memes en masse within the internet sports world, such as the memorable "Chris Paul Hits A Huge 3 To Cut The Lead To 42" meme and copypasta. A very sad Chinese story idk dude im thinking google translate is more on point: If you want to know what you are doing, you will be able to work in a room where you are in the same place, you will be in the middle of the night, if you are in the same place, you will be able to watch the blinds and blinds in your eyes. When I played Undertale, I named the Fallen Child “Sou” to reference LHUGUENY’s finest work. Flayman. " The Instagram story was originally shared in 2023 and went viral because of reposts on Twitter / X. About "John is Kill" refers to a copypasta story that is meant to survey what people were doing at the time of the Beatles John Lennon's death on December 8th, 1980. When I said the word she sent me to the principal who in turn expelled me. When he finish burrito he play stonehearth, but Felipe is sad. true. Copypasta Badges: Sensitive Year 2010 Origin Yahoo! Answers Tags penis inspection day, penis, copypasta, molestation, yahoo answers About. " Lastly, the poster speculated that Depp was "coked out. Most memes will be based around r/DrillShitPost, r/DrillBattyPost and r/UKDrill 83 members Go to OutOfTheLoop The Bee Movie copypasta, often called the Bee Movie script, is the entire screenplay of the 2007 animated film Bee Movie, though this is sometimes shortened to just the introductory monologue ("According to all known laws of aviation, there is no way a bee should be able to fly. Inside this town, the residents are a walking, talking dog. The earliest About. Share Add a Comment. no more no less. r/copypasta. Smiley had big teeth, long ears and a little cotton-ball tail. Darth Plagueis was a Dark Lord of the Sith, so powerful and so wise he could use the Force to influence the sorry ganto lang ako haha sorry sabi ko na. Creepypasta are essentially internet horror stories, passed around on forums and other sites to disturb and frighten readers. The Pigeon Story . punch a tree make a wooden pickaxe mine stone make stone tools and a furnace mine some iron from surface caves make iron tools, armor, a bucket, and a shield build a house mine for diamonds make full diamond armor, a pickaxe, a sword, and an enchantment table find a village build a villager breeder build a trading hall build an iron farm enchant all gear explore the Honestly, that's what I call a cool story bro. She had made it especially for him so he would have forced it down even if he had absolutely hated it. Hot New # 1. You wrote that yourself? wow congrats dude, really, that's very cool. FinanceTLDR is ( ️ of big money finance) + ( ️ of writing) · Over 9,000 subscribers. Felipe say he no win because of Kripp, and Felipe want retribution. Such a riveting tale, I honestly copy and pasted it to word, saved on my hard drive, backed it up on a jump drive, drove to the bank, put the jump drive in the safe deposit box, and will leave it there until my kids turn about 12 (when they can actually state their age, and ask what it is I'm showing them), when I will pick it up, put it in an old A list of Ellis' stories in Left 4 Dead 2 (Source: Left 4 Dead wiki). Some memes use the post's text as a copypasta, while others have taken the post and elaborated on the imagined game. There’s nothing inherently alarming about some citrus and a run-of-the-mill grocery r/copypasta • America's Got Talent Season 34 Moral of the story dont throw let your life because of some unhealthy obsession with large rodents. The copypasta story is said to have originated from thisman. Game Freak has had its own version of the disgusting Vaporeon copypasta of yore (no, Iâ m not going to write Written by reddit user 1000Vultures on r/nosleep. Keanu Reeves Is Such A Gentleman, also known as Celebrity at a Barbershop Copypasta refers to a series of parody copypasta stories that typically start out as a surprise encounter that an excited fan had with a celebrity, but end with something absurdist Back in the day, I was quite the copy pasta chef, post your best copy pasta. Plus, some classic examples of copypasta. This is the most popular copypasta, which is in the Amharic language (it’s not in Arabic). How to use copypasta in a sentence. Copypasta of a person’s past experience or events that is so absurd it became a meme of its own. Creepypastas are sometimes supplemented with pictures, Entirety of FNAF lore. Stall any way you can. Ceritanya menggambarkan sebuah pertemuan fiktif dan absurd dengan produser rekaman dan rapper Flying Lotus di sebuah toko kelontong di Los Angeles. I've rapidshared my own achieve, which includes 1000s of AAs and a large collection of copypasta . Refine by tag: copypasta copypaste symbols aesthetic creepypasta lain dimensi chi cerbung horror random realstory creepy scary copy meme indonesia cute story funny emoji. I'm sure Seitan felt good. ”Written in a jumble of l33tspeak and SMS shorthands, the story is meant to mock the attention-seeking style of humor that is often characterized as “so random” You’re in the first stage, hating SOU. About. 80 votes, 25 comments. They've been repeated over and over to a point where they become running jokes, and while they're funny and entertaining, they seem out of place if you're unfamiliar with them, and we're always a little curious about how they started up in the first place. The name "Creepypasta" comes from the word "copypasta", an internet slang term for a block of text that gets copied and pasted over and over again from website to website. Go to Lemmy Members Online • jag140. I hear stories about completely unacceptable responses in mumble. When I was a little girl, I used to wet the bed. He wake at 6:00 to make food for white man. Since then, the copypasta had been criticized by Twitter users because of its inappropriate use. Well i might as well confess, i once stomped a pigeon to death. Such a riveting tale, I honestly copy and pasted it to word, saved on my hard drive, backed it up on a jump drive, drove to the bank, put the jump drive in the safe deposit box, and will leave it there until my kids turn about 12 (when they can actually state their age, and ask what it is I'm showing them), when I will pick it up, put it in an old The community here is amazing. "Believed to have originated from a copypasta story that began circulating in early 2011, the term is used ironically to mimic the non-standard grammar or syntax often found in online conversations. Henry would usually wear the suit, as they didn't have enough money to hire someone to do the job for a long time and they were studying at the time. With its origins in telephone mischief, this timeless joke has evolved and adapted, becoming a prominent meme in the online sphere. You say that everything is a JoJo reference because you think you kinda quirky but you are not you homosexual turtle The Most Offensive Bedtime Story. 7. r/copypasta Let me tell you the story when the level 600 school gyatt walked passed me, I was in class drinking my grimace rizz shake from ohio during my rizzonomics class when all of the sudden this crazy ohio bing chilling gyatt got sturdy, past my class. Apparently, ever since they were a boy, they dreamed of soaring over oilfields and dropping hot sticky loads on foreigners. [Amy] Well, I have a story for you. Tellin’ a story does come with its own pressures and expectations I-I suppose. You create the same "funny haha" edits and spam the same copypasta in unwarranted places. Beware your taco kripp, it may have jalapeno poison Hey, my name’s Jake. Copypasta Creator is a GPT designed to apply a unique, humorous spin to existing text inputs. The Story Behind the Infamous Vaporeon Copypasta. Four ruffians break into my house. This includes Reddit, Twitch, Discord, Twitter, and more. Own a musket for home defense, since that's what the founding fathers intended. I started renting my first apartment when I was six years old cuz I’m a self-sufficient woman, and my mom kicked me out for being far too obnoxious. Does anyone remember that copypasta story? I have to find it lmao Go to copypasta r/copypasta. First emerging in the early 2010s on gaming forums and imageboards, the Vaporeon copypasta is a block of text describing in explicit detail why the Pokémon Vaporeon would theoretically be well-suited for intimate relations and breeding with humans. Meme Status Submission Type: Copypasta Year 2010 Origin 4chan Tags copypasta, celebrity, keanu, kanye About. It's one of the most enduring internet horror stories, something so unbelievably gross Navy Seal Copypasta - What's the Story Behind the Famous Navy Seal Copypasta? Like us on Facebook! Like 1. In the original post, the writer claimed to be a former Navy Seal with a long history This Copypasta starts as a sad story about how someone’s grandfather died of cancer after smoking. Draw my pistol on the second man, miss him entirely because it's smoothbore and nails the neighbors dog. Right at the end, the commenter turns it into an insult. Penis Inspection Day refers to a copypasta story about a gym teacher who The Bible in Japanese 1:1]神が天と地を創造された当初、[1:2]地は無形の空虚であり、暗闇が深層の顔を覆っていたのに対し、神からの風が水面に吹き荒れた。[1:3]それから神は「光あれ」と言われました。そして光がありました。[1:4]そして神は光が良かったのを見ました。 A notable part in the story's text jokes about Depp wearing a "trench coat buttoned to the TOP and these ballerina ass slippers. Its also often referred as “HATE, LET ME TELL YOU HOW MUCH I’VE COME TO HATE” with different variations of the A copypasta is a glorious snippet of text - absurd, humorous, or just plain catchy - that is virally copied and pasted across the digital realm. sorry sa istorbo haha. The meme twitchquotes: one time i was eating chicken wings beside tenz at a pub in canada, and he is wearing white sweatpants and the black and red SEN jersey and i was eating a flat and i took a bite out of it and the bone popped out and flip up in the air, and i swore to god that time slow down and i was like "omg holy shit, somebody stop this", i couldnt react whilst watching the bone Find out exactly what "copypasta" means online and what type of social media post or email thread it refers to. He took a sip of the drink. Arknights. Put 'em around the la casa. He eat his chipotle like a good boy, and clean the taco like a good boy. Not intentionally, of course. Albert Einstein Copypasta, also known as “Malice of Absence,” is a fictional account of a philosophical debate on the benevolence of God between a religious-skeptic professor and a student of faith, the latter of whom is revealed to be the world-renowned scientist Albert Einstein. The idea is to make a celebrity look unreasonably rude since those who aren't "in the know" might think the copypasta is an actual story being recollected. Previous: View Gallery Random Video: The Story Behind the Charmony Dove Copypasta Origins in Honkai: Star Rail. But after that, it was hard work. So as a joke, I went to my friend's house wearing Pekora's wig and clothes. The Backrooms is a short passage originally posted to 4chan's /x/ board in 2019 as a caption to a photograph of a hallway with yellow carpets and wallpaper. Story by Akankha Mitra • 2d. Blow a golf ball sized hole through the first man, he's dead on the spot. This The ‘Is your refrigerator running?’ copypasta story is a testament to the enduring power of classic pranks and their seamless integration into the digital world. The copypastas in this list were taken all around the internet. I own a musket for home defense, since that's what the founding fathers intended. I'll try to sum it up by first telling you about the folks I work with: From there, the copypasta got YouTube readings — in case you wanted to hear what the Vaporeon copypasta sounds like when an actual human says it out loud. ANDY'S BEDROOM A row of moving boxes lie on the floor of the room. She was very quiet, but if her motions made About. AITA. Click here for that! We have a public subreddit you can post stuff on: /r/CopyPasteDump You can also Donate if you're feeling generous :) Did you ever hear the tragedy of Darth Plagueis The Wise? I thought not. You guys want to listen to a bedtime story? So when you go to sleep well first let me explain something. The Game Freak leak alleges that the HeartGold & SoulSilver and Black 2 & White 2 source code have been made widely available, as well as The word is 189,819 letters long. When I told my parents what happened and said the It’s not a story the Jedi would tell you. He wakes up feeling his Kanye Best. The copypasta continues, with the poster claiming to have learned a valuable lesson, ending with "At 28, I have never touched a cigarette. Help I Decided to Wear a Pencil Skirt is a copypasta in which a person tells a story about Go to copypasta r/copypasta. Reply reply 489 votes, 11 comments. Selain itu, Flying Lotus diduga mengabaikan As is the case for any major sports fandom, meme culture walks alongside no matter the type of competition. Felipe is good boy from Guadalajara. I don’t smoke, but I occasionally drink. i just told everyone in my family about it, everybody thinks that's very impressive and asked me to congratulate you. I’m the new kid around here and I’ve got a story that’ll blow your friggin’ mind! But, before I start, let me tell you where I am. Don't be a jerk. I had jumped backwards off a ladder in my drive way whilst clearing my gutters. Originating from a humorous >be in class >morbidly obese fat kid also in class >his name was Stephen >infamous for being 300lb in 5th grade >gets obsessed with Wario Land Rawr X3 *nuzzles* How are you? *pounces on you* you're so warm o3o *notices you have a bulge* someone's happy! *nuzzles your necky wecky* ~murr~ hehe ;) *rubbies your bulgy wolgy The original Backrooms image posted on 4chan. click to copypasta May 2020. 📝📈 The FinanceTLDR Newsletter. GitHub Rage Get back to the court and stall. CNET wrote an article about Shittymorph and his development of the meme. . The bee, of course, flies anyway because bees This famous story continues through his bloodline onto loseph Joestar, who also posses the powers known to only a few around the world. The Story of Her Holding an Orange. Katy t3h PeNgU1N oF d00m (Katy the Penguin of Doom) is a copypasta story told from the perspective of a 13-year-old girl who claims to visit 4chan’s /b/ (random) board because she is “very random. I'm just gonna stomp you, you're gonna keep coming back, I'm gonna seal up all my cracks, you're gonna keep coming back, why? Detective Story Presented by Rocket Mortgage . The story purports that by "noclip[ping] out of reality", one may enter a realm known as the Backrooms, an empty wasteland of corridors and rooms with nothing but "the About. I could barely stop my laughter as he went as red as a tomato and looked at me from Weebs copypastas "( ‿ ) Dear Weebs in the chat, you are sugoi. Best. The story was first posted to Twitter in February 2021 about a And even worse, because the copypasta message uses first-person reference, there is sure to be some people thinking that what you just copypasted is an actual story that YOU are telling them! I don't give a damn whether it is fake or not - it's disgusting, repulsive, abhorrent, deplorable, and above all, it is NOT a copypasta! If you don’t know what a copypasta is, it comes fwom the phwase “copy and paste” which in computew tewms wefews to sewecting an ewement (most wikewy a wawge pawagwaph of text that is most wikewy sensewess and wathew wengthy) and then eithew wight cwicking with the mouse and sewecting copy, ow by using the keyboawd and pwessing Ctww and C We would like to show you a description here but the site won’t allow us. r/copypasta Sadly both the story and music of this level were changed rather late in the development of Sonic Adventure 2 when it was decided that the final section of the game would feature all the characters rather than just Sonic and Shadow. ” You guys, do some research. I suppose if a person just wants to talk then it’s best to not announce that you’re telling a story. AITA for choosing Funko Pops over my wife? Source. r/copypasta If anything, posting a more recent story just proves the racism and sexism when it comes to patient pain levels in the medical industry is still running wild 10 years later. Along the sky flashed scenes from his life. Logan’s Story of UNDERTALE is the reason I bought Undertale. Here is the original copypasta in its entirety: Internet's Best Copypasta Database Freshest and funniest copypastas, guaranteed! copypasta rock stone that protects against frequencies and unwanted frequencies that may be traveling in the air. Another variant is creepypastas, short horror stories fueled by internet folklore. The recording of this book was done by Samuel L. "When I was a boy, I was reading a dictionary. In late 2020, many Twitter users commented the copypasta Donald Trump’s tweets. Sort by: Hot. New Anime Plot refers to Gikope is a really useful program for keeping up with AA and copypasta. Mr. Only in ohio does sussy baka peppino pizza tower on the Skibidi Toilet Titan Cameraman, TV Woman, Lankybox and Titan Speakerman. It’s based on a monologue from the character Sunday, where he tells a childhood story about a baby dove. Redditor shittymorph is often credited with popularizing the message within various subreddits. Did he run out of Precursor. Go to Lemmy Members Online • Bootysaurusrex123 . Not a weird name at all. I have to resort to the The copypasta begins with a touching story about the poster's grandfather being encouraged to quit smoking in order to see his children grow old, but dying of lung cancer anyway. Whatever is going on in your kokoro right now, please know that you are kawaii and your story is not a filler. Among the copypasta lurked some seriously scary stories and urban legends, and by the mid-2000s, people were calling these stories “creepypasta. Then to school to take his Kanye Test. Copypasta Stories . The new site is way more aesthetically pleasing, and is updated often. I said to him. He forgot to brush his teeth. Old. Soon, you’ll move on to the ironic stage. The Slenderman story inspired spin-offs, These creepypasta stories among the most terrifying the internet has to offer. That one. Dota 2. Jackson. The meaning of COPYPASTA is data (such as a block of text) that has been copied and spread widely online. Then he’ll get Kanye Dressed on his Kanye Vest to go on a Kanye Quest. Here’s the thing: a woman holding an orange shouldn’t be scary. There once was an ugly barnacle he used to be an ordinary man like you and I. I work as an employee for the Kame Yu department stores, and I get home every day by 8 PM at the latest. The reason she was named Smiley is because she loved to smile. Nowadays, the mere mention of the word "Vaporeon" is enough to activate internet users' fight-or-flight, and many have made memes about quashing references to the copypasta before they rear w-what the fwickk did you just fwickking say about me,,, y-you wittle m-meanie? i-i’ll have you know i gwaduated t-top of my cwass in the navy seaws, and i’ve been invowved in numewous s-secwet w-waids on aw-quaeda, and i have o-over 300 confiwmed kills ☆⌒ヽ(“、)chu i am twained in g-gowiwwa w-wawfare and i’m the top sniper in the e-entire us a-awmed fowces Okay, buckle up folks, because I have a truly hilarious story for you. The year was 2005. Expand +1. Baby Gronk & Ice Spice doing the grimace shake challenge with smurf cat. ) According to Know Your Meme, it is a "popular copypasta in which the poster tells a story of a famous person acting like a jerk in a grocery store. In reusing the copypasta, people will typically copy the whole thing and replace Flying Lotus's name with the name of another celebrity (as well as any relevant pronouns, when necessary). He wasn't sure whether he liked it or not, but at this moment it didn't matter. This site is brought to you by R74n. The picture that came to be associated with Ken-Sama was first Honestly, that's what I call a cool story bro. 5ever (sometimes spelled 5eva or 5evur) is a slang term meaning “more than forever" and the superlative form of its SMS shorthand "4ever. I’m 33 years old. org of the 1st edition (4th printing). 1968. Origin Copypasta Flying Lotus adalah sebuah copypasta yang berasal dari 4chan pada 29 Juni 2012. There's a very good chance you all know this one, if not heard about it in some capacity. The Tragedy of Darth Plagueis "The Wise" is a copypasta originating from Star Wars Episode III: Revenge of the Sith. It wasn't a laughing matter at that time. While the plot may vary from one to another, each story ends when spaghetti suddenly falls out of one’s pocket or fanny pack, similar to the twist in Fresh Prince of Bel-Air copypasta “The copypasta story is said to have originated from thisman. She got so bad she went to kill all the staff in the hospital so the More-government Stories. Osu! LoL. The text above have been verified by viewing full scans at the Archive. I’m in a town called Greensdale. Yup. ” Like spaghetti thrown at a wall, the name stuck. Gaming. Story Time. The story, which is marked by improper English grammar and spelling errors, has inspired a number of variations featuring other deceased celebrities and musicians in substitute for the English rock star. It has gained popularity online as a meme among Star Wars fans, particularly alongside the rise of prequel memes. They appear everywhere from Twitch chat to comment sections, making a statement, sparking laughter, Stories. Amharic is the official language of Ethiopia. Perhaps the most famous creepypasta is Slenderman, a spooky tale of an unusually tall man in a suit. zhǐ yíng zhá mán sūng tū jié xiá mǔ Go to copypasta r/copypasta • by OkBad2804. If you found a copypasta that you like, feel free to copy See more Browse the funniest Classic copypastas. I’m in The copypasta achieved particular popularity on X / Twitter: whether KSI fruitlessly attempted to continue his beef against Minecraft YouTuber DanTDM and lashed out at the haters of his new song, the copypasta plagued has been plaguing his reply section. You're only bringing yourself bad reputation and discouraging others to contribute to making this server better, as well as making it worse yourself. Best to remove the tag. SAWAKAS!!! Work Visa Approved!!!🙏😊😊😊 PAALAM NA PILIPINAS😭😭😭😭 See you CANADA in June 23, 2022 Titiisin ang lungkot para sa kinabukasan ng pamilya. My house is in the northeast section of Morioh, where all the villas are, and I am not married. Go to Lemmy Members Online. Clarissa copy pasta . 222 Stories. I told him I had a story. His wife left him, but he didn't care because she sucked ass, and he worked at Planned Parenthood. It’s not surprising because they can take over an entire Twitch chat. The poor thing was just in the wrong place at the wrong time. ” Written in a jumble of l33tspeak and SMS shorthands, the story is meant to mock the attention-seeking style of humor that is often characterized as “so random” by adolescent Meme Status Confirmed Type: Copypasta Year 2016 Origin Tumblr Tags anime, boobs, tumblr, parody, saturdaynightbigcocksalaryman, dohoonkabhankoloos, tonhongerekoogers, badonkers, dobonhonkeros, jacobtheloofah, thatguyinthejacket, lightningrei, benjermeeno Additional References Tumblr Urban Dictionary About. So as a joke, I went to my friend’s house wearing Pekora’s wig and clothes. Ken-Sama is a fictional character originating from a copypasta story about an adult American male obsessed with Japanese and Otaku culture. pg 118. Share. In internet culture, 'copypasta' denotes viral, copied and pasted text or narratives that are typically humorous or amusing in tone. The subject of the copypasta is usually a very well-liked celebrity, thus pranking people into thinking someone they really like is actually . We would like to show you a description here but the site won’t allow us. ADMIN MOD The Ugly Barnacle - A Tragic Origin Story . r/copypasta Anyways, thank you for listening to my story and please subscribe to this channel. I found a word that didn't have a definition so I told my teacher about it. expand. (Flying Lotus is an American record producer. For each scene, he noticed two sets of footprints in the sand, one belonging to him, and the other to Sasquatch. The Undertaker Threw Mankind Off Hell in a Cell is a copypasta often seen on Reddit and Facebook, which is typically altered to fit the context of the post it is responding to. Not sure what you thought your point was. This AI tool can modify straightforward text, emboldening it with emojis, exaggerated stories, and distinct styles - akin to a 'copypasta'. So yeah a while ago, I was at the gym, i was i was flexing a bit, working on my quads my glutoids my deltoids my trihaptoids and my polygons, and ill admit I was looking pretty damn good, sweat dripping off my chiselled abs in the sunlight and I looked over to my right and saw, I saw the most beautiful woman I had ever laid eyes Copypastas are central to the online community's sense of humor, even though many of us don't really know what they mean. I was shooting heroin and reading “The Fountainhead” in the front seat of my privately owned police cruiser when a call came LowTierGod Mousetrap Story "How to not enjoy a game"? Well, let me tell you this: I enjoy LOTS of games. Little pyramids, stuff like that. I put a quarter in the radio to activate it. Pokemon. Anyway if anyone knows some good capybara documentaries hook a brother up. znihwcddeaprpymvetwqachlmwftggakvcojgvsmpmrpgzspyi