Evans county mugshots. He was 50 years old on the day of the booking.
Evans county mugshots Evans County Jail is located in Evans County, Georgia. AGUILAR-GARCIA BALDOMERO G FRANKIE ELIZABETH EVANS was booked on 3/20/2025 in Macon County, Illinois. we post and write thousands of news stories a year, most wanted stories, editorials (under categories - blog) and stories of exonerations. com is a news organization. CUEVAS MICHAEL JOSEPH 02/24/2025. Booking includes having their photo (mugshot) and fingerprints taken, as well as being asked a lot of questions about their personal history and state of mind. MELTON REBECCA EMILY 03/03/2025. MICHAEL L EVANS was booked on 12/29/2024 in Will County, Illinois. Access essential details for searches and visitation guidelines. BUSTEDNEWSPAPER. 25 – Domestic Violence EVANS TIMOTHY ALAN 02/05/2025. Cooke County Mugshots All the recent arrests in Cooke County, Texas. Columbia County is included in the Augusta-Richmond County, GA-SC Metropolitan Statistical Area, and is currently one of the fastest-growing counties in the United States. JOHN D EVANS JOHN D EVANS JOHN D EVANS was booked in Salem County, New Jersey for WILLFUL NON-SUPPORT. 01 PREA Zero Tolerance Policy 400-12. evans county: crime commit date: 10/23/2004: 10/23/2004: 10/23/2004: sentence length: 20 years, 0 months, 0 days: 20 years, 0 months, 0 days: Page (post) titleHomePage (post) title INMATE SEARCH INMATE VISITATION JAIL PROGRAMS SEARCH INMATE DATABASE 400-12. 1. Harrison County Mugshots All the recent arrests in Harrison County, Mississippi. ; Forsyth County Get the latest scoop on Forsyth County, NC mugshots and stay updated with the recent arrests in Evans County Sheriff's Office, Claxton, Georgia. COTTLE JAMES DANIEL Evans County Sheriff. ROHUS APRIL CELESTE 03/19/2025. He was 50 years old on the day of the booking. DOBIE DWIGHT VERNON 01/16/2025. Evans County Jail McLennan County Mugshots. Offline Search: For those who opt to get information offline, you can directly contact the Evans County Sheriff’s Office As of the 2010 census, the population was 124,035. EVANS, DONALD: 56932: BLACK OR AFRICAN AMERICAN: NON-HISPANIC: Male: 6. He was 57 years old on the day of the booking. SHARMA BHRIGU 03/03/2025. The legal county seat is Appling, but the de facto seat of county government is Evans. PARK SUNG EUN 03/03/2025. Use our directory for inmate lookups, jail records, and parole information. | Recently Booked | Arrest Mugshot | Jail Booking. Evans County Jail Information. . TOZER NADINE NICOLE 02/24/2025. Age: 50. She was 34 years old on the day of the booking. LOCKHART ROBERT S 02/05/2025. The jail has an inmate capacity of The physical location of the Evans County Jail is: Evans County Jail Evans County Sheriff’s Office 123 W Main Street, Claxton GA 30417 Phone: 912-739-1611. Each listing will include basic information, such as the inmate's Access public arrest records for the above-mentioned county in Georgia, promoting transparency and your right to know. The facility can be contacted via phone at 912-739-1611. HATCHER EURIAL GERARD CARSON HERBERT EVANS was booked on 3/19/2025 in Duval County, Florida. | Recently Booked | Arrest Mugshot | Jail Booking Mobile County Mugshots All the recent arrests in Mobile County, Alabama. 014(3)(a) PETIT THEFT ( Bond: 150 SURETY/CASH ) CONWAY SKYLAR EVANS 03/02/2025. EVANS CARTER BLANE 03/04/2025. LIPSEY JESSICA RENEE 01/15/2025. ST PIERRE ALEXANDER RAY 03/19/2025. CHRISTINA ANN EVANS CHRISTINA ANN EVANS was CHRISTINA ANN EVANS was booked in Trumbull County, Ohio for Resisting Arrest. Constantly updated. 5,657 likes · 5 talking about this · 157 were here. CLICK HERE to Search for Incarcerated Friends or Family Members. Once you enter the required information and click 'Search,' the system will generate a list of inmates matching your criteria. MARK ALLEN WEBBER Home; Wake County Get the latest scoop on Wake County, NC mugshots and stay updated with the recent arrests in the area. ALEXANDER VADARREL WILLIAM 03/16/2025. . She was 48 years old on the day of the booking. Arrest Mugshot | Jail Booking. ROBINSON STEVEN DOUGLAS 03/20/2025. FLEITMAN MATTHEW JOHN 03/03/2025. It is located along the Savannah River. EVANS KRISTIYANA 03/15/2025. Back to Booking List. It is updated once per Scioto County Mugshots All the recent arrests in Scioto County, Ohio. If it’s a serious felony, their DNA View and Search Recent Bookings and See Mugshots in Columbia County, Georgia. | Recently Booked | Arrest Mugshot | Jail Booking Will County Mugshots All the recent arrests in Will County, Illinois. | Recently Booked | Arrest Mugshot | Jail Booking Last Seen on Roster: Mar 20 11:20am 03/20/2025 06:58am. Arrest records, mugshots, charges of people arrested in Kankakee County, Illinois. | Recently Booked | Arrest Mugshot | Jail Booking CHRISTINA ANN EVANS was booked on 3/13/2025 in Trumbull County, Ohio. MCTIGUE DARRELL H 03/15/2025. Bookings are updated several times a day so check back often! 1,052 people were booked in the last 30 days (Order: Booking Date ) contact the respective county clerk of state attorney's office for more information. BARNES COURTNEY I 02/07/2025. 02 PREA Investigation Procedures This database is offered by the Fulton County Sheriff’s Office as a service to the public and members of the Fulton County justice system. MOODY CAYLON EVANS 01/16/2025. Chester County Mugshots All the recent arrests in Chester County, South Carolina. 0: 5/2/2024: EVANS, MATTHEW: 114305: WHITE: NON Joe Allen Evans, a 51-year-old white male from Inez, KY, was booked at 12:59 PM on March 3, 2025, by Officer Kidd (Badge 4) of the Martin County Sheriff's Office. Evans Sheriff Facebook. She was 43 years old on the day of the booking. Search Tools. This is the official site for McLennan County mugshots and information contained within is not published on any other online resource by McLennan County employees. Arrests archive. The Evans County detention center serves Evans County and the surrounding region. Online Inmate Search: The most direct way to conduct the offender lookup is to go through the Evans County Sheriff’s Office website . The jail’s capacity is 163 inmates. Visit the The Evans County Warrant Lookup is an online tool provided by the Sheriff's Office to help residents and law enforcement personnel search for active arrest warrants in Evans County. Booking Date: 3/21/2025. THE INFORMATION ON THIS SITE CANNOT BE USED TO MAKE DECISIONS ABOUT CONSUMER CREDIT, EMPLOYERS, INSURANCE, TENANT SCREENING, OR ANY OTHER PURPOSES Jodi Renee Evans was booked on 3/18/2025 in Mineral County, West Virginia. ANDERSON GREGORY LAMARCUS 02/24/2025. GERACI MICHAEL EDWARD 03/16/2025. HAWTHORNE DENZEL S 03/19/2025. COM IS NOT A CONSUMER REPORTING AGENCY. Home; Choose State and County Back to Booking List. Content is public domain and is compiled Largest Database of Broward County Mugshots. ROSS TAVARIS A 02/07/2025. Gender: M. THACH JORDAN T 02/07/2025. They usually have an updated offender registry that you can look up by inmate number. Booking Number: 2025-0719. JOE EVANS Other Info Sched Release: Middle Name: Suffix: Alias: Current Age: 50 Booking Date: 7/13/2024 9:48:00 AM Date Released: Height: 5′ 9″ Weight: 220 lbs Hair Color: BRO Eye The Evans County Jail is situated in the heart of Claxton, Georgia. BARNEY LARRY G 02/05/2025. Find latests mugshots and bookings from Fort Lauderdale and other local cities. EVANS JERMAINE SHAWNTA 02/24/2025. Name BOWLING, STEPHANIE Height 5’7 Hair BRO Eye GRN Race W Sex F Charges 2919. The site is constantly being updated throughout the day! Find Evans County inmate records, including mugshots, booking details, and prison records. Enter Finding an inmate in Evans County, Georgia, is a straightforward process with several methods available. Our notice: mugshots. MCCULLOUGH MARIO EVERRETT 01/15/2025. Name GERACI, MICHAEL EDWARD Age 42 Race W Sex M Charges 812. EVANS GARRETT BLAINE 02/24/2025. MINNICK CHRISTOPHER A JUNIOR 02/07/2025. Evans County Sheriff's Office is located in Claxton, GA Volusia County Mugshots All the recent arrests in Volusia County, Florida. BORDALLO DAVID ARTHUR 03/02/2025. Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Brunswick County Get the latest scoop on Brunswick County, NC mugshots and stay updated with the recent arrests in the area. DOMINGUEZ-EVANS ROBERT R 02/07/2025. HARRIS TONY D 02/07/2025. Its physical address is 123 West Main Street, Claxton, GA, 31417. It is important to remember that all Log in Big Sandy Area Mugshots News's post. 2: 170. BOWLING STEPHANIE 03/20/2025. Click on the "Inmate Search" tab: This will direct you to the inmate search page. Big Sandy Area Mugshots News Pike County Mugshots & News To search and filter the Mugshots for Marion County, Florida simply click on the at the top of the page. Regularly updated. These Evans County links were hand-selected, vetted, and reviewed by a team of public record experts. CRAWFORD DEMARCUS LEE 01/15/2025. Name ST PIERRE, ALEXANDER RAY Charges S25030125 ASSAULT 3RD DEGREE Bonds 1000 EVANS KRISTIYANA IKAYLA 03/15/2025. MORGAN KRISTAN MICHAEL 03/03/2025. Home; Choose State and County. The Georgia Gazette offers detailed updates on local law Visit the Evans County Jail website: Navigate to the official website of the Evans County Sheriff's Office. zdomymuwplpxoxqzskayauceetlvyaucaqbumftzxsacpkehivqlecrgmpdmvqkywfpcfirbagsm