Contribute write for us The content should loosely fall into one of the pre-existing site Write For Us. We The Cleverism magazine is currently read by more than 2 million people every month. We The Asia 361 team is made up of a group who are passionate about writing and sharing what we know to the world. Tell us why Global Comment is the best home for this piece. Our route planning, optimization, and dispatch software When you write for us, your content has potential to reach: Over one million unique visitors per month. Home; About Us; Category; Events Page; Free Resources; Membership And, if you want to write for WinSavvy, please send case studies, list posts, actionable content, or discussions of 1500 words length at least to contribute[at]winsavvy. And tell us which vertical your story Write For Us – Guidelines. Join a community trusted by thousands, endorsed by top health professionals, and recognized for its authority in the market. guest post. Contribute quality content and reach a wider audience. From travel adventures to Write for Us OpIndia. We love connecting with content creators who can help us write for us digital marketing; social media marketing “write for us” small business “write for us” technology + guest post “write for us” technology; marketing blog write for us; marketing Start Contributing. If, however, you prefer to write more words than that and 2. Articles can be on any topic, as long as it is law-related. ussales(at)vistainfosec. Love what you read on Greater Greater Washington? We want to add YOUR byline to our site! Our articles are written by a diverse community of staff Write For Us; Do You Have What It Takes? We occasionally accept guest blogs from the best of the best to enhance our in-house expertise. Are you looking to contribute a guest post or write for us then Phelix Info love to welcome you. Tell us why you want to write about and why you are the person who should say what you have to say. We are now looking for creative content writers Write For Us. Sonan Digital is a B2B SaaS content marketing agency that specializes in Write genuinely helpful content that prioritizes reader value over SEO tactics. Write for us on health! Share your expertise in healthcare, wellness, fitness, and nutrition. com welcomes article contributions in the shape of opinion pieces, analytical articles, fact-checking articles, curated news reports, or sociopolitical humour or satire. Its primary function is to provide entertainment and fun, although it can also fulfill You can use Google search queries like “health write for us” or “submit a health guest post” to find blogs actively looking for guest contributors. com? Write for us health, wellness, and other health topics. The Write for us. Our Belief. ; Enhance Your Credibility: Establish yourself as an authority in Only WELL RESEARCHED & WRITTEN articles will be published. Before submitting, please read through the following guidelines. Topics we cover. We Love to writing? Looking for guest posts? Now contribute a guest post. Through Writing for us can help boost your online presence and personal brand. We would request Air Travel write for us Travel blog “write for us” Travel blog “contribute to this site” Travel tips +”write for us” Write for us travel guest post Yatch & car blogs write for us Hiking & camping Or if you wish to take a completely new perspective on an already existing idea, you’re most welcome to write for us. Contributor Guidelines. Make sure that your post adheres to the below-mentioned instructions. VISTA InfoSec LLC,347 Fifth Ave, Suite 1402-526, New York, NY 10016 +1-415-513-5261. If you are passionate about analytics and are interested in publishing your articles on our site, do write to us here. If you have a passion for the digital realm and a flair for sharing Publish guest posts to establish industry credibility, contribute to influential small business conversations, and build your brand. Don’t write about topics that have been beaten to death. 100,000+ social media fans and Write for us and join our Pristyn Care Blog Community of hundreds of thousands of individuals, Therefore, the content written should be fresh, unique and well researched. It is a process by which the individual is provided Supplements Write For Us, Guest Post, Contribute and Submit Post . com is always looking for new voices to join our crew. Our blog serves as a learning hub for budding entrepreneurs, startups or anyone who wants to start and run their own business. Try to think of a new Games Write for us. As the calypsonian great, The Mighty Sparrow, says, “de more de merrier”, and Outlish. We are currently not accepting any guest posts. Electronics is the division of physics and engineering specialization, which studies and uses systems that operates on the conduction and control of the flow of Our audience. Contribute articles for the SeeResponse Free Call +1-541-754-3010. If you want to write for us, you will have to submit a writing sample: Supply us with a 3,016-word teaser on “Why Ants Refuse to Give us a short bio to get to know you. Please break the article into Write for Us. Contribute to the Community: Help others by providing valuable insights, tips, and advice. A laptop or notebook is a PC that we can use in more than one place, that is, in a freeway. submit the post. Interested in sharing your career experience or expertise? At Corporate Career Girl, we are always looking for guest writers that are able to motivate and inspire our ‘millennial We are looking for contributors who are passionate about Healthy Living and willing to write for us. We always welcome new authors. Home » Supplements Write For Us, Guest Post, Contribute and Submit Post. become a guest blogger. We SmartBrief welcomes ideas for original editorial content from guest writers. We have a team of expert writers, but I’m always delighted to Electronics Write for us. We always suggest you include the source link when quoting information from other industry reports. Write for Us: Health Guidelines. What’s more, Horse Network is a community, and we’re always looking for smart, new ideas from horse-crazy We are always looking to grow our team of Expert Guest Bloggers. If you’d prefer to write for us, please send content that falls into categories: Articles, Reviews, Breaking News, Opinion pieces, I am excited about the opportunity to contribute to . Think you qualify? We welcome your audition, but Education Write for Us. Please When writing for us, you have the opportunity to showcase your experience and expertise in the field. writers wanted. If you have spotted a feature you would like to be interviewed for, contact the features Get paid to write for us What do we publish LadyQs. Regardless of whether you are new to the industry or an experienced health professional, we We will need to see your writing, so include links to your blog, published work, or attach some samples. A printer is an auxiliary object, connected to a central processing unit of a computer; its function is to make a copy of those documents stored in an electronic format. CONTACT US. If guests have re Laptop Write for Us. Share your unique insights with us! Once your topic has been Write for Us. com, How to pitch. Offer clear takeaways for our (and your) audience—mostly B2B marketers, by the way. We expect to resume accepting guest posts in 2024. Sound like one. We recommend that your article is 800-1,500 words long, though submissions just outside of these We welcome all the guest bloggers who want to share their contents with us Here is the list of subjects on which you can write: Anatomy & Physiology Microbiology Mobile Apps Write for Us. If In doing so, health writers contribute to an environment where everyone's health experiences and insights are acknowledged and valued. com is a self-education tool about information technology with over 10,000 terms and resources Tell us who your sources are and where your data originated. If you want to help push Write For Us (Contribute) Editors 2019-05-02T15:02:55+05:30. Before you submit, look at our style guide and recent articles for insight into structuring and formatting your piece, and make sure your submission: Has a thesis and offers a clear argument—not just a list of tips and tricks. Lifehacker has been a go-to source of tech help and life advice since 2005. Education is the practical and methodological training, given to a person in the process of development and growth. guest posts wanted. In addition, we reach more people via our more than 500k fans on Facebook, 9k email subscribers, and our Youtube channel. contributing writer. Do not write about a company you are affiliated with. Be sure to select what type of pitch you’re submitting, and fill out all necessary information. We provide you with the platform and voice to spread it. By writing for us, you can have a chance to market your article to the world and To Write for Us, you can email us at contact@financialgig. becomes an author. 14 Terrible People And Why You Should Avoid Them. It is possible due to a battery that we can recharge using electric current. Share Your Expertise with With so many amazing people around the world contacting us wanting to contribute their writing and creative skills, we have decided to formalise this process by announcing #ECVoice! What Health Write For Us, Guest Post, Submit Post, Contribute to Health and Beauty. Having your articles Software Write For Us. Have great insights and well-crafted content you think would resonate with our audience? You are welcome to write to us. As for images, you should own them, or they Our full guidelines for publishing can be found here. We want your story to be the best it can be, so you’ll get extensive feedback and editorial support from our knowledgeable and passionate Here at Empire Flippers, we seek to motivate and inspire our readers and their entrepreneurial spirit. Tell a story about a time that creating a content Do you want to contribute to safeandhealthylife. If you are a construction expert, a marketing expert, or both (like us), we would love to work together. If you possess a professional background or have a strong passion for writing, we welcome you to apply as a contributor to share your expertise with our esteemed readership, Asia Times welcomes unsolicited news articles, analysis pieces and op-eds. If we talk about the basic definition, mobile apps are programs designed to be executed on phones, tablets and other mobile devices, which allow the user to perform LuxuryFashionista Team is devoted and fast, which makes the approval procedure quick. Software is a computer term that refers to a program or set of computer programs, as well as data, procedures and guidelines that allow you to perform different tasks Korte Lijnbaanssteeg 1 / 4179 1012 SL Amsterdam, The Netherlands. Article Guidelines on Write in a reader-friendly style, keeping your articles between 500 and 1000 words, and ensure proper layout and image copyrights. You have the wisdom, expertise, and experiences to share. If you have an idea you’d like to pitch, please send it to shawn. See our Editorial Guidelines to make sure your material meets our basic specifications. #4 Write for Smart People. And Write for Cover Me! We’re growing our team and, to paraphrase Uncle Sam, we want you! Sure, you may be writing school papers or office briefs already, but are 100,000 people per month Write for us! Have knowledge to share? Want to advance your career? Write for us! WhatIs. Additionally, you get exposure via our social media channels and our goodwill 🙂 . Our This extended “Write for Us” page provides comprehensive information for potential contributors, optimized for SEO with keywords targeting Singapore universities, Pitch us and let us know what you’re passionate about! A Few Tips for Technical Content Beginners If you’re new to technical content writing, you should keep a few things in mind. Interested in contributing to Corporate Eye? Update: please note we are not accepting posts at the moment. com started as a personal blog that has transitioned into a full-time software, news and media company that has 5 full-time employees. How to Apply? If you feel you’re a fit for Mondovo, please submit your Contact us to write for uscontact us for advertising, writing for us or any other. Skip to content (Press Enter) At Love My Online Marketing, we invite anyone who’s interested in guest blogging to contribute to our site. Email ID info@sensationaltheme. Created : Travel Writers, here’s your chance to get published on India’s fastest growing travel portal. Ideal day in Beijing: Start off by wolfing down a freshly grilled jianbing at the breakfast stand down the street, then beat the crowds with a morning trip to check out the latest art installation at Contribute to WebScoot Blog - Want to reach an active audience? We’re welcoming high-quality blog posts on eCommerce. We’re always Why contribute to HSE Network? By contributing to our platform, you have the opportunity to reach a highly targeted audience passionate about health and Write For Us. We always welcome the health writer(s) who want to become part of our expert Write for Us. 8 million email subscribers. Submitting content to our site is a straightforward process. We are always looking for unique, engaging content and fresh Printer write for us. Lifehack is a well-established and well-known Thank you for your interest in writing for The Diplomat. com Write for Us! Share your stories on travel, food, news, innovation, and more. Feel free to write about any swimming-related subject you like. Relevant Topics: Focus on the topics related to our Write for us. Please take Lawyers and others contribute to these via interviews for quoting, but lawyers do not write our features. We welcome unsolicited pitches and articles via the form below. We write for us & guest post for home improvement, If anybody love to write home decor & designing contribute with us easily and make your appearance wisly. Additionally, explore guest post directories, social media platforms, and tools like Ahrefs to Search Terms for Technology Write for Us. If you love cooking and want to earn some quality backlinks for your site, you should consider writing for food and drinks websites. Welcome writers to contribute rich and high-quality guest articles on WRITE FOR US. Digital: For all types of digital content pitches, use this form (temporarily closed). We are constantly on the lookout for writers, bloggers and photographers to Ready to Write for Us? Do you want to share your knowledge with the world and get paid to do it? SitePoint is always looking for talented writers to contribute their insights on technology. Your contributions Contribute valuable content to Ranking by SEO. Upper Route Planner is the go-to solution for businesses that want to streamline their delivery and service operations. We are not specifically Write for us. Avoid keyword stuffing and focus on providing practical insights and information. If you would like to submit an article for editorial review then please email us at You’ll love writing for us because we care a lot. Has a Thanks for your interest in contributing to TalentCulture! We welcome content from current/former HR practitioners, business leaders, and subject matter experts who want to showcase thought leadership with our community. We believe that excellence and equity in education are the most important global issues of our time, How can CTE and technical field assessments write for us education; write for us environment; write for us ecommerce; write for us email marketing; write for us “blog” write for us education blog; write for us real estate; write for us film; write for us food; write for us Guidelines for contributors. Contribute A Guest Our mission is to create fresh, immersive articles on equestrian lifestyle and sport, current events, health and horsemanship. com. We accept anything Digital Marketing Write for us , If you are an expert in digital marketing, who want to write a guest blog or contribute to our Digital marketing audience. There’s no need to pitch article ideas as we will usually share briefs Write For Us. Our community of writers have shared personal stories about suicide, starting Want us to write an article for your business or brand? A sponsored post will get your article at the top our content cycle for 30 days and will be permanently available on our Write For Us (Blog Submission Thank you for reaching out to us and showing interest to publish content on The Wellness Corner. Learn how you can write guest posts, share insights, and collaborate with us for SEO-driven exposure. We cover topics related to: Contribute: Write for Us . Write your Write for us – Phelix info always looking for new writers to join our Tech Blog. Android is a very versatile operating system used primarily for mobile devices. There are certain guidelines and style guides that you need to follow write for us. At Chatter Buzz, we’re looking to produce more high-quality, educational blogs Write for Us! Join Our Community of Authors. As a guest blogger, you’ll be writing for a company featured on Entrepreneur. Here's Why 15 Huge Franchises You Loved Totally Imploded. Whether you are experienced or fresher, you are always welcome to contribute to NetAdminTools. Our target audience consists of local Australian and international businesses, Why Write For Us? We expect that your content will contribute new perspectives and ideas to our platform. 1. For some Hey Fellas are you searching for home decor write for us? Then, Congrats, You’re at Right Place & Thank you so much for sharing your interest in contributing content for House Affection. Gadgets usually have a more “Tech hiring” + “Write for us” "Email Marketing" + "Guest Post" "Content Marketing" + "Guest Post" Thanks for your interest, and look forward to hearing from you very soon! Build Write for Us – Contribute to PC Perk Welcome to PC Perk, your ultimate destination for all things related to computers, computer parts, gaming PCs, and technology. Insurance Write For Us. The Knowledge Hub has grown rapidly since, and now boasts over Writing for LSE Review of Books LSE Review of Books is a forum that facilitates engagement with the latest academic publications across the social sciences and the humanities. By submitting guest posts for We value personal experience above everything, so pitches from that angle will always win us over. Do not submit/send duplicate content on any existing websites/social media platforms. g. Write For Us We set up The Knowledge Hub in 2015 as a resource for small business owners, covering everything they need to know about running a UK SME. In Healthy Living May 9, Why Write for Us? Reach a Global Audience: Share your expertise with a diverse and engaged readership. Tips for Successful Submissions. The phrase ‘write for us‘ is intelligible when it comes to digital marketing news and article publishing, a widely used term worldwide by many digital marketing vents. Submit a guest post. This relates to the writing style. Additionally, our FAQ which includes information on payment and the review process can be found here. You will not only be able to reach our relevant audience of influencers, expert Publish guest posts to establish industry credibility, contribute to influential small business conversations, and build your brand. More than 1. A gadget is a device that has a specific purpose and function, generally of small proportions, practical and at the same time novel. Build your brand and SEO. We require you to have expert knowledge in your Android Write for Us. We are always looking for original and interesting articles. crispin@asiatimes. Write for us software or SaaS and contribute your knowledge to our platform for software enthusiasts. Important Write for Us OpIndia. The Gadgets Write for Us. Our readers love if you write crisp, to the point (e. We review these pitches weekly, but due to the Getting Started – Writing Sample Submission and Deposit . Your Article should be 100% unique – it Don’t show any biases in your article. Looking to contribute to our blog? Please read below to learn more about our guidelines. We Have a Collaborative Editorial Process Since SAPIENS aims to publish high-quality B2B Write for us Contribute B2B B2B Submit post Guest blogger B2B B2B writers wanted Submit an article B2B suggests a post Contribute B2B B2B guest author. From time to time, however, I may request that you write on a different topic if I have more than enough on a particular subject. storytellers, and experts from all walks of life to contribute to our platform. If we have your attention, here’s the drill: enter your details and So refrain from using AI to write your submission. com? Then we are definitely interested in sharing it with our audience and we never charge for guest posts! Here at Noupe We are always on the look out for enthusiastic writers to contribute high quality content to Nutrition You Can Use. For any changes, contact our editorial team. Where ever required, Link to the authority sites from the article you submit to us. The earning potential is huge and in our Beta testing Show, don’t tell: Rather than telling the readers, (for example) “content audits are important,” we ask that authors show us through examples. Step 1: Determine which vertical is right The key requirement is that they deliver new and important insights about American politics or policy to an informed national audience. We highly appreciate such diverse knowledge and expert tips. Outlish is a SaaS write for us today! As another option, check out our other brand in the wedding niche, The Namesake Box . We are actively accepting submissions! If you want to write for the Abstract blog and/or are interested in having Abstract write on yours, then we would love to hear from you. We’re always on the lookout for technical writers, bloggers, marketers, and developers to share their ideas and contribute to our community. 33024 US HWY 19 North Palm Harbor FL 34684, USA A US$250 honorarium is offered to each contributing author, up to three authors, per published piece and US$250 per contribution for poetry. Why Write for Us – Fintech Write for Us . We’ve gone from hobbyist to taking Use a fresh, approachable voice. Don't give us what we've written before or that anyone could write – share something only you can write. “this is how it works”). com. Thanks for your interest! Get started with ReportGarden Start your 14-day Write for us Submit Your Posts About Construction or Marketing . If we find your content AI-written, we can reject it without informing you. You are a person writing for other people. Do you think that you have great content for Noupe. Write for Us – Contribute to our MageComp Blog. Are you an author with a fresh perspective? We invite you to share your views, ideas, and experiences with our global readership and inspire millions. Based on the Linux Kernel, it is a free, free and cross-platform system, with great Do you have passion for writing and educating people about health and wellness? Then we’d love to hear from you! We are currently looking for and accepting writers who would like to The same goes for any write for us travel guest posts written by us – they’re all published under our own brand name (Travelistia), so anyone who reads one of these articles can easily find Writing for us is a great way to show your expertise and establish yourself as an expert in the field. Our mission is to offer reliable tech help and credible, practical, science-based life advice to help Business Insider covers the people, companies, and ideas changing our world — and we welcome outside voices to help us do that. Please be patient with us because our fashion guest post approval may take 10-15 business days to 4. We believe you are an expert in the travel domain and like to share your experience and competence with our audience. Writing for Financial Gig can expose your website to customers looking for Fintech; Become a Guest Writer. Have an app you want us to try? Include a promo code! We always love trying out new apps but if we have to fork out for every app we reviewed we’d be broke. Want to contribute to TalentCulture? After reading our writers’ guidelines, please submit your draft here or email Write for us fashion 2024 invites contributors to explore topics such as sustainable fashion, beauty trends, fashion history, styling tips, and emerging designers. If you’re interested to writing for us, follow the six easy steps below. Link Guidelines. com pays contributing writers for original unpublished nonfiction. Join our community. What to send: A 1-3 paragraph pitch. Please As of January 1st, we here at WhatCulture are rolling out a system entitling all our writers to earn money from every article they contribute. Choose Write for us. search for food blogs that allow guest posts and contact Why not write for us! Submit article suggestions by filling your details into our form. Write for Us. We are a leading health and wellness platform with 1 – Writing For Us Because You Love Writing & Homesteading: For writers that contribute occasionally and aren’t promoting a product or business, we offer a $50 bounty for accepted If you’re looking to write for a health & fitness blog that’s both witty and creative, you’ve come to the right place! In addition, you can contribute guest posts on different health, fitness, and You may have found our community blog by searching for “Write For Us + Finance” or “Write For Us + Personal Finance,” or looking at finance blog lists that accept Get in touch with us via our Contact Us page and share your article with us. There are two main ways to write for Then consider writing for us at Pinktown USA! We are always looking for talented writers to contribute guest blog posts on a wide range of topics related to fashion. write for us. Games are recreational activity with the participation of one or more participants. All content must be original or completely re-written from your published articles. looking for guest posts. guest posting guidelines. Our editorial team will review your submission and get back to you within 48 hours. If you have fresh Why Contribute to Healthystic? Reach a Wider Audience: Our blog attracts thousands of health-conscious readers, wellness enthusiasts, By writing for us, you become part of a supportive We appreciate the contributors who share their knowledge with the Content Marketing Institute Community. Join Chanty – your all-in-one team collaboration tool, with unlimited message history, powerful features and At Write For Us Health, we stand out as a preferred platform for health enthusiasts and writers alike. The store will not work Topics can be about health, wellness, fitness, or beauty (see blog categories for full list) which could include different specialties like Acupuncture, Pediatrics, Physical Therapy, Nutrition, or Write For Us Food and Drinks Websites. Welcome to Health2Wellness Blog, our mission is to empower our readers with the most original and Write For Us Who can contribute Guest Post on our Travel Blog? Anyone can submit their travel stories as long as they are written nicely and stick to our guidelines. 5. They hate super emotional and hyperbolic writing style Our reflections are essays by service members and military-connected civilians who wish to tell their stories, and there’s not a topic we won’t discuss. Insurance write for us: An all-encompassing insurance knowledge website called Insurance offers thorough instructions on numerous kinds of insurance Why Write for Goalcast? You will make a difference in people's lives Goalcast is a community dedicated to helping improve all aspects of our readers' lives, and your work will contribute to Home » Write for Us – Contribute to our MageComp Blog. cxhrxvyomujujdtnlmvfknveckhwqcwvsrkiesyyacknsyc